Protein display: Turbot (Scophthalmus maximus) IGH V-REGIONs

Only the *01 allele of each functional, ORF and in-frame pseudogene V-REGION is shown.

Dots indicate gaps according to the IMGT unique numbering. Blanks at the 5' and/or 3' end indicate partial sequences.

____________________________________________________________________________________________________________________________________________________

       IGHV                          FR1-IMGT           CDR1-IMGT       FR2-IMGT      CDR2-IMGT                 FR3-IMGT                  CDR3-IMGT
       gene                           (1-26)             (27-38)        (39-55)        (56-65)                  (66-104)                  (105-115)
___________________________ __________________________ ____________ _________________ __________ _______________________________________ ___________
                            1       10        20         30         40        50         60         70        80        90        100        110
                            .........|.........|...... ...|........ .|.........|..... ....|..... ....|.........|.........|.........|.... .....|.....

#c AJ296096,IGHV1S1                                                           GMHWIGM RSTGVS.... YYKDSLK.NKFSIDLDTCSKTVTLNGQNVQPEDTAVYYC AK.........

#c Rearranged cDNA


Created: 15/11/2001
Author: Nathalie Bosc
Contact: Marie-Paule Lefranc

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Research, 27, 209-212 (1999) Cover of NAR; Ruiz, M. et al., Nucleic Acids Research, 28, 219-221 (2000); Lefranc, M.-P., Nucleic Acids Research, 29, 207-209 (2001); Lefranc, M.-P., Nucleic Acids Res., 31, 307-310 (2003); Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5, 45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33, D593-D597 (2005) Full text; Lefranc, M.-P. et al., Nucleic Acids Research 2009 37: D1006-D1012; doi:10.1093/nar/gkn838 Full text.

For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

IMGT Repertoire (IG and TR)
IMGT Repertoire (MHC)
IMGT Repertoire (RPI)
IMGT Index
IMGT Scientific chart
IMGT Education
IMGT Home page


IMGT founder and director: Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
Bioinformatics manager: Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager: Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster: Chantal Ginestoux Chantal.Ginestoux@igh.cnrs.fr
     

Citing IMGT
Warranty disclaimer and copyright notice
Privacy policy and advertisement policy

© Copyright 1995-2010 IMGT®, the international ImMunoGeneTics information system®